Beginner
- Dose
- 20 mcg/dia Original in PT-BR
- Frequency
- 1x ao dia (SC) Original in PT-BR
- Duration
- 4 semanas Original in PT-BR
- Notes
- CAUTELA. Monitorar glicemia. Comer carboidratos 30 min após injeção. Original in PT-BR
KNOWLEDGE · COMPOUNDS
IGF-1 LR3
Growth hormonePreclinicalPubMed records: 30count from PubMed, not curated
Overview
O IGF-1 LR3 é uma versão modificada do Fator de Crescimento Insulínico tipo 1 (IGF-1) com substituição de arginina na posição 3 e extensão de 13 aminoácidos no N-terminal. Essas modificações reduzem drasticamente a ligação às IGF Binding Proteins (IGFBPs), que normalmente inativam o IGF-1 circulante, resultando em meia-vida estendida de 20-30 horas vs apenas 12 minutos do IGF-1 nativo. É um dos compostos mais potentes para crescimento muscular (hiperplasia — aumento do número de células, não apenas do tamanho). Original in PT-BR
IGF-1 LR3 is catalogued under Growth hormone. 21 Eagle articles in this library reference this compound.
- Category
- Growth hormone
- Research stage
- Preclinical — Pré-Clínico Original in PT-BR
- PubMed records
- 30 (count from PubMed, not curated)
- Eagle articles on this compound
- 21 Eagle articles
Mechanism
Agonista do receptor IGF-1 com meia-vida estendida — anabólico, hiperplasia muscular, redução de ligação a IGFBPs Original in PT-BR
O IGF-1 LR3 liga-se ao receptor IGF-1R com alta afinidade, ativando as vias PI3K/Akt e MAPK/ERK, que promovem síntese proteica, proliferação celular e inibição da apoptose. Sua reduzida afinidade pelas IGFBPs significa que permanece ativo na circulação por muito mais tempo que o IGF-1 nativo (PMID: 11884379). Promove tanto hipertrofia (aumento do tamanho das células musculares) quanto hiperplasia (aumento do número de células por diferenciação de células satélite). Porém, essa potência traz riscos: risco de hipoglicemia (IGF-1 compete com insulina) e potencial de promover crescimento tumoral em indivíduos predispostos. Original in PT-BR
Eagle articles on this compound
Chemical information
- CAS
- 946870-92-4
- Molecular formula
- Proteína modificada de 83 aminoácidos Original in PT-BR
- Molecular weight
- 9111,40 g/mol pt-BR notation
- Sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Amino acids
- 83 counted from the sequence above
- Solubility
- Água bacteriostática (solução ácida pode ser necessária) Original in PT-BR
- Stability
- Frágil — reconstituído utilizar em 7–14 dias refrigerado Original in PT-BR
- Half-life
- ~20–30 horas (vs 12 min para IGF-1 nativo) Original in PT-BR
- Bioavailability
- Alta (SC/IM) Original in PT-BR
- Onset
- Dias (efeitos anabólicos progressivos) Original in PT-BR
- Routes
- SC · IM
Research references
No individual dosing recommendation is given. Values are as recorded in the source, with species and route stated where known.
Third-party research score
50/ 100
Score assigned by the imported source, on its own scale and with no published methodology. Eagle does not compute it, does not verify it and does not endorse it. It appears here to preserve the record, not as an assessment.
Demonstrou que IGF-1 induz hipertrofia muscular através da via calcineurina/NFAT, com potencial para hiperplasia de células satélite. Original in PT-BR
PMID: 11884379Year: 2002Species: Not recorded as a structured field in the source.Route: Not recorded as a structured field in the source.Duration: Not recorded as a structured field in the source.Purpose: Not recorded as a structured field in the source.Revisão abrangente dos efeitos anabólicos do IGF-1 no músculo esquelético, incluindo síntese proteica e diferenciação de mioblastos. Original in PT-BR
PMID: 7549776Year: 1995Species: Not recorded as a structured field in the source.Route: Not recorded as a structured field in the source.Duration: Not recorded as a structured field in the source.Purpose: Not recorded as a structured field in the source.
Safety
Commonly reported
- Hipoglicemia (sintomas: tremor, suor, confusão) — especialmente em jejum
- Dor articular
- Inchaço nas extremidades
Serious
- RISCO DE HIPOGLICEMIA GRAVE — sempre ter carboidrato de rápida absorção à mão
- Potencial de promover crescimento tumoral — contraindicado com qualquer histórico de câncer
- Acromegalia com uso prolongado (crescimento de tecidos moles: mandíbula, mãos, pés)
Contraindications
- Qualquer histórico de câncer — ABSOLUTA
- Diabetes tipo 1 ou 2 (risco de hipoglicemia grave)
- Gravidez ou amamentação
- Menores de 25 anos (placas de crescimento abertas)
Warnings
- COMPOSTO DE ALTO RISCO — requer supervisão e conhecimento avançado
- Sempre comer uma refeição com carboidratos dentro de 30 min após injeção
- Monitorar glicemia diariamente durante uso
- Não combinar com insulina exógena sem supervisão médica
Original in PT-BR — This text was written in Brazilian Portuguese and is shown as recorded. Open the PT-BR page for IGF-1 LR3.
Lab tests named in the source
- IGF-1 (OBRIGATÓRIO)
- Glicemia de jejum (OBRIGATÓRIO)
- HbA1c
- Insulina
- Marcadores tumorais (PSA, CEA, AFP)
The source names the tests and nothing else: no reference values and no thresholds. None were added here. Interpreting a result is a clinical act and is not offered on this page.
Reported protocols
Recorded in the imported source as community protocols. They are NOT Eagle protocols, were not reviewed by Eagle, and are not a dosing recommendation, a prescription or clinical guidance. Values appear exactly as recorded, in the language they were written in.
Intermediate
- Dose
- 40 mcg/dia Original in PT-BR
- Frequency
- 1x ao dia (SC ou IM pós-treino) Original in PT-BR
- Duration
- 4 semanas ON / 4 OFF Original in PT-BR
- Notes
- IM no músculo treinado para efeito local. Monitorar glicemia diariamente. Original in PT-BR
Advanced
- Dose
- 50 mcg/dia Original in PT-BR
- Frequency
- 1x ao dia Original in PT-BR
- Duration
- 4 semanas máximo Original in PT-BR
- Notes
- Dose máxima recomendada. Supervisão obrigatória. Risco aumentado de hipoglicemia. Original in PT-BR
Dosing summary as recorded
- Dose Padrão
- 20–50 mcg SC diário Original in PT-BR
- Frequência
- 1x ao dia Original in PT-BR
- Rota
- SC ou IM (peri-treino para IM) Original in PT-BR
- Ciclo
- 4 semanas ON / 4 semanas OFF Original in PT-BR
- Timing
- Pós-treino (IM) ou manhã (SC) Original in PT-BR
- UI na Seringa
- 5 UI = 50 mcg (frasco 1mg / 1mL BAC) Original in PT-BR
Vial sizes: 0.1mg · 1mg — Peptide Calculator
Interactions
These relations come from the imported reference material, which records one label and one comment per pair and no source: no PMID, no population or model, no evidence type and no degree of certainty. Eagle did not verify them and does not endorse them. «Compatible», «Caution» and «Avoid» are the imported material's wording, not an Eagle authorisation or prohibition, and none of this is medical advice.
Caution
BPC-157 faz upregulation do receptor de GH e IGF-1 — pode amplificar efeitos do IGF-1 LR3. Monitorar. Original in PT-BR
CJC eleva GH → eleva IGF-1 endógeno. Combinação com IGF-1 exógeno pode causar níveis suprafisiológicos. Original in PT-BR
Mesmo raciocínio do CJC-1295. Monitorar IGF-1 total. Original in PT-BR
Related
No linked article matches that search.