Beginner
- Dose
- 50 mcg/dia Original in PT-BR
- Frequency
- 1x ao dia (SC) Original in PT-BR
- Duration
- 2 semanas Original in PT-BR
- Notes
- Dose conservadora. Avaliar resposta imune antes de aumentar. Original in PT-BR
KNOWLEDGE · COMPOUNDS
LL-37
RepairPreclinicalPubMed records: 80count from PubMed, not curated
Overview
O LL-37 é o único membro da família das catelicidinas expresso em humanos. É um peptídeo antimicrobiano de 37 aminoácidos que começa com dois resíduos de leucina (LL). É produzido naturalmente por neutrófilos, macrófagos e células epiteliais como primeira linha de defesa contra infecções. Possui atividade antimicrobiana de amplo espectro contra mais de 38 espécies bacterianas, 16 espécies fúngicas e 16 vírus documentados. Além da ação antimicrobiana direta, o LL-37 também modula a resposta imune inata. Original in PT-BR
LL-37 is catalogued under Repair. 19 Eagle articles in this library reference this compound.
- Category
- Repair
- Research stage
- Preclinical — Pré-Clínico Original in PT-BR
- PubMed records
- 80 (count from PubMed, not curated)
- Eagle articles on this compound
- 19 Eagle articles
Mechanism
Destruição de membranas de patógenos + imunomodulação + cicatrização Original in PT-BR
O LL-37 atua por disrupção direta da membrana celular de patógenos. Sua estrutura anfipática (com regiões hidrofílicas e hidrofóbicas) permite que se insira nas membranas bacterianas, criando poros e causando lise celular (PMID: 15466917). Diferentemente de antibióticos convencionais, é difícil para patógenos desenvolverem resistência ao LL-37, pois seria necessário reformular toda a estrutura da membrana. Adicionalmente, o LL-37 recruta e ativa células imunes (neutrófilos, monócitos), promove angiogênese e acelera cicatrização de feridas (PMID: 19145231). Como imunoestimulante, deve ser evitado em pacientes usando imunossupressores. Original in PT-BR
Eagle articles on this compound
Chemical information
- CAS
- 154947-66-7
- Molecular formula
- C₂₀₅H₃₄₀N₆₀O₅₃
- Molecular weight
- 4493,33 g/mol pt-BR notation
- Sequence
- [LL-37, 37 aa]
- Amino acids
- 37 counted from the sequence above
- Solubility
- Água bacteriostática Original in PT-BR
- Stability
- Reconstituído: 7–14 dias refrigerado (2–8 °C) Original in PT-BR
- Half-life
- ~4 horas Original in PT-BR
- Bioavailability
- Alta (SC) Original in PT-BR
- Onset
- Dias (atividade antimicrobiana imediata) Original in PT-BR
- Routes
- SC
Research references
No individual dosing recommendation is given. Values are as recorded in the source, with species and route stated where known.
Third-party research score
60/ 100
Score assigned by the imported source, on its own scale and with no published methodology. Eagle does not compute it, does not verify it and does not endorse it. It appears here to preserve the record, not as an assessment.
Revisão abrangente da estrutura, mecanismo de ação e amplo espectro antimicrobiano do LL-37, cobrindo atividade contra bactérias Gram+ e Gram-, fungos e vírus. Original in PT-BR
PMID: 15466917Year: 2004Species: Not recorded as a structured field in the source.Route: Not recorded as a structured field in the source.Duration: Not recorded as a structured field in the source.Purpose: Not recorded as a structured field in the source.Demonstrou que LL-37 vai além da ação antimicrobiana direta, modulando a resposta imune inata por quimiotaxia de neutrófilos e ativação de monócitos. Original in PT-BR
PMID: 23085662Year: 2013Species: Not recorded as a structured field in the source.Route: Not recorded as a structured field in the source.Duration: Not recorded as a structured field in the source.Purpose: Not recorded as a structured field in the source.Demonstrou que LL-37 promove angiogênese e migração de queratinócitos, acelerando a cicatrização em modelos de ferida cutânea. Original in PT-BR
PMID: 19145231Year: 2009Species: Not recorded as a structured field in the source.Route: Not recorded as a structured field in the source.Duration: Not recorded as a structured field in the source.Purpose: Not recorded as a structured field in the source.
Safety
Commonly reported
- Irritação leve no sítio de injeção
- Vermelhidão local
Serious
- Em doses altas pode causar citotoxicidade (dano a células próprias) — respeitar dosagem
- Potencial de ativação imune excessiva em indivíduos predispostos
Contraindications
- Uso concomitante com imunossupressores (golimumabe, anti-TNF, corticosteroides) — CONFLITO DIRETO
- Doenças autoimunes ativas — pode exacerbar inflamação
- Gravidez ou amamentação
- Psoríase (LL-37 está super-expresso em lesões psoriáticas)
Warnings
- IMUNOESTIMULANTE FORTE — ativa imunidade inata vigorosamente
- Doses baixas são recomendadas (50–100 mcg/dia)
- Monitorar marcadores inflamatórios durante uso
Original in PT-BR — This text was written in Brazilian Portuguese and is shown as recorded. Open the PT-BR page for LL-37.
Lab tests named in the source
- Hemograma com diferencial
- PCR
- VHS
- Procalcitonina
The source names the tests and nothing else: no reference values and no thresholds. None were added here. Interpreting a result is a clinical act and is not offered on this page.
Reported protocols
Recorded in the imported source as community protocols. They are NOT Eagle protocols, were not reviewed by Eagle, and are not a dosing recommendation, a prescription or clinical guidance. Values appear exactly as recorded, in the language they were written in.
Intermediate
- Dose
- 100 mcg/dia Original in PT-BR
- Frequency
- 1x ao dia (SC) Original in PT-BR
- Duration
- 2–4 semanas Original in PT-BR
- Notes
- Dose padrão para suporte imune. Monitorar marcadores inflamatórios. Original in PT-BR
Advanced
- Dose
- 100 mcg 2x/dia Original in PT-BR
- Frequency
- 2x ao dia (SC) Original in PT-BR
- Duration
- 2 semanas apenas Original in PT-BR
- Notes
- Apenas para contextos de infecção ativa. Curto prazo. Supervisão médica. Original in PT-BR
Dosing summary as recorded
- Dose Padrão
- 50–100 mcg/dia SC Original in PT-BR
- Frequência
- 1x ao dia Original in PT-BR
- Rota
- SC Original in PT-BR
- Ciclo
- 2–4 semanas Original in PT-BR
- Timing
- Manhã Original in PT-BR
- UI na Seringa
- 4 UI = 100 mcg (frasco 5mg / 2mL BAC) Original in PT-BR
Vial sizes: 5mg — Peptide Calculator
Interactions
These relations come from the imported reference material, which records one label and one comment per pair and no source: no PMID, no population or model, no evidence type and no degree of certainty. Eagle did not verify them and does not endorse them. «Compatible», «Caution» and «Avoid» are the imported material's wording, not an Eagle authorisation or prohibition, and none of this is medical advice.
Compatible
Antimicrobiano (LL-37) + reparo tecidual (BPC-157). Compatível para cenários de feridas contaminadas. Original in PT-BR
Caution
Ambos imunoestimulantes. Combinação pode causar ativação imune excessiva. Original in PT-BR
Avoid
LL-37 estimula imunidade inata + KPV inibe NF-κB. Direções opostas podem reduzir eficácia de ambos. Original in PT-BR
Related
No linked article matches that search.