Skip to content Inauguração emGrand opening inInauguración en --d --h --m --s · Cadastro VIP ›· VIP sign-up ›· Registro VIP › Abrimos hoje · aguardeWe open today · hold onAbrimos hoy · aguarde Loja aberta! Entrar ›Store open! Enter ›¡Tienda abierta! Entrar ›
Eagle Pharma
Track order WhatsApp

KNOWLEDGE · COMPOUNDS

TB-500

Also known as: Thymosin Beta-4 fragment · TB4 fragment

RepairClinical trialsPubMed records: 1039count from PubMed, not curated
Ask Eagle AI about this compound

Overview

O TB-500 é um fragmento peptídico sintético da Timosina Beta-4 (Tβ4), uma proteína de 43 aminoácidos presente em praticamente todas as células do corpo humano. A Timosina Beta-4 é uma das proteínas mais estudadas no campo da regeneração tecidual, com mais de 1.000 estudos publicados no PubMed. O TB-500 contém a região ativa central responsável pela regulação da actina e migração celular, tornando-o um potente promotor de reparo sistêmico. Original in PT-BR

TB-500 is catalogued under Repair. 43 Eagle articles in this library reference this compound.

Category
Repair
Research stage
Clinical trials — Fase 2 Clínica (Timosina Beta-4) Original in PT-BR
PubMed records
1039 (count from PubMed, not curated)
Eagle articles on this compound
43 Eagle articles

Mechanism

Regulação da actina (proteína G-actina), migração celular, angiogênese sistêmica Original in PT-BR

O TB-500 atua primariamente através da regulação da proteína G-actina, componente fundamental do citoesqueleto celular. Ao sequestrar monômeros de G-actina, o TB-500 previne a polimerização excessiva e permite que as células mantenham a plasticidade necessária para migração ao sítio de lesão. Este mecanismo é fundamentalmente diferente do BPC-157 — enquanto o BPC-157 promove angiogênese e reparo local via NO/VEGFR2, o TB-500 facilita o transporte e a reorganização celular em escala sistêmica. Adicionalmente, o TB-500 promove diferenciação de células-tronco, reduz fibrose e atenua a inflamação crônica. Em modelos cardíacos, demonstrou capacidade de recrutar células progenitoras para reparo miocárdico (PMID: 22074417). Original in PT-BR

Eagle articles on this compound

Chemical information

CAS
77591-33-4
Molecular formula
C₂₁₂H₃₅₀N₅₆O₇₈S
Molecular weight
4963,44 g/mol pt-BR notation
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Amino acids
43 counted from the sequence above
Solubility
Água bacteriostática Original in PT-BR
Stability
Estável reconstituído por 28 dias refrigerado (2–8 °C) Original in PT-BR
Half-life
~6 horas (estimativa animal) Original in PT-BR
Bioavailability
Alta (SC/IM) Original in PT-BR
Onset
1–2 semanas para efeitos perceptíveis de reparo Original in PT-BR
Routes
SC · IM

Research references

No individual dosing recommendation is given. Values are as recorded in the source, with species and route stated where known.

Third-party research score

80/ 100

Score assigned by the imported source, on its own scale and with no published methodology. Eagle does not compute it, does not verify it and does not endorse it. It appears here to preserve the record, not as an assessment.

  • Demonstrou aceleração significativa na cicatrização dérmica em modelos animais, com aumento da migração de queratinócitos e deposição de colágeno. Original in PT-BR

    PMID: 20560983Year: 2010Species: Not recorded as a structured field in the source.Route: Not recorded as a structured field in the source.Duration: Not recorded as a structured field in the source.Purpose: Not recorded as a structured field in the source.

  • Ativação de ILK resultou em recrutamento de células progenitoras cardíacas e melhora funcional do miocárdio pós-infarto em modelo murino. Original in PT-BR

    PMID: 22074417Year: 2012Species: Not recorded as a structured field in the source.Route: Not recorded as a structured field in the source.Duration: Not recorded as a structured field in the source.Purpose: Not recorded as a structured field in the source.

  • Demonstrou que Tβ4 promove migração e diferenciação de células-tronco foliculares, resultando em crescimento capilar acelerado. Original in PT-BR

    PMID: 17276549Year: 2007Species: Not recorded as a structured field in the source.Route: Not recorded as a structured field in the source.Duration: Not recorded as a structured field in the source.Purpose: Not recorded as a structured field in the source.

  • Acelerou a cicatrização corneal com redução significativa de fibrose e inflamação ocular em modelos animais. Original in PT-BR

    PMID: 24039053Year: 2014Species: Not recorded as a structured field in the source.Route: Not recorded as a structured field in the source.Duration: Not recorded as a structured field in the source.Purpose: Not recorded as a structured field in the source.

Safety

Commonly reported

  • Leve vermelhidão ou inchaço transitório no local da injeção
  • Sensação de letargia ou fadiga temporária nas primeiras aplicações
  • Dor de cabeça leve (raro)

Serious

  • Nenhum evento adverso grave reportado na literatura disponível
  • Perfil de segurança extrapolado do extenso corpo de pesquisa sobre Timosina Beta-4

Contraindications

  • Câncer ativo ou histórico de câncer (angiogênese e proliferação celular)
  • Gravidez ou amamentação
  • Precaução com infecções ativas sistêmicas

Warnings

  • Fase de loading (4–6 semanas) com dose mais alta é recomendada antes da manutenção
  • Não necessita de aplicação diária — ação sistêmica permite espaçamento entre doses

Original in PT-BR — This text was written in Brazilian Portuguese and is shown as recorded. Open the PT-BR page for TB-500.

Lab tests named in the source

  • Hemograma completo (CBC)
  • PCR (Proteína C Reativa)
  • Fibrinogênio
  • CK (Creatina Quinase)

The source names the tests and nothing else: no reference values and no thresholds. None were added here. Interpreting a result is a clinical act and is not offered on this page.

Reported protocols

Recorded in the imported source as community protocols. They are NOT Eagle protocols, were not reviewed by Eagle, and are not a dosing recommendation, a prescription or clinical guidance. Values appear exactly as recorded, in the language they were written in.

Dosing summary as recorded

Dose Loading
2–5 mg, 2x/semana (4–6 semanas) Original in PT-BR
Dose Manutenção
2 mg, 1–2x/semana Original in PT-BR
Rota
SC ou IM Original in PT-BR
Ciclo
Loading 4–6 sem → manutenção contínua Original in PT-BR
Timing
Manhã (ação sistêmica ao longo do dia) Original in PT-BR
UI na Seringa
10 UI = 500 mcg (frasco 5mg / 1mL BAC) Original in PT-BR

Vial sizes: 5mg · 10mg — Peptide Calculator

Interactions

This section brings together two origins. The ones Eagle wrote come from its own curated library, one by one; the rest come from the imported reference material, which records one label and one comment per pair and no source. Neither kind carries a PMID, a population or model, or a degree of certainty. Eagle did not verify the imported ones and does not endorse them. «Compatible», «Caution» and «Avoid» are not an Eagle authorisation or prohibition, and none of this is medical advice.

Reported synergy

  • BPC-157

    O 'Wolverine Stack': BPC-157 (ação local, angiogênese) + TB-500 (ação sistêmica, migração celular). Mecanismos completamente distintos sem sobreposição — sinergia máxima para reparo completo. Original in PT-BR

  • GHK-Cu

    TB-500 recruta células para reparo + GHK-Cu estimula síntese de colágeno no sítio. Ação complementar para regeneração de pele e tecido conectivo. Original in PT-BR

Compatible

Caution

Related

View all (43)

← Back to knowledge area